PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID BGIOSGA036149-PA
Common NameOsI_38424
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family M-type_MADS
Protein Properties Length: 92aa    MW: 10324 Da    PI: 10.4632
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
BGIOSGA036149-PAgenomeRISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF79.42.5e-251059251
                      ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
            SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                      rien+  rqvtfskRr g+lKKA+E+ vLCd++va i+fs +g+l+ y+s
  BGIOSGA036149-PA 10 RIENEVSRQVTFSKRRPGLLKKAHEIAVLCDVDVAAIVFSAKGNLFHYAS 59
                      8**********************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.3E-34160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006629.072161IPR002100Transcription factor, MADS-box
SuperFamilySSF554557.85E-27262IPR002100Transcription factor, MADS-box
CDDcd002656.40E-36275No hitNo description
PRINTSPR004042.6E-27323IPR002100Transcription factor, MADS-box
PfamPF003192.0E-241057IPR002100Transcription factor, MADS-box
PRINTSPR004042.6E-272338IPR002100Transcription factor, MADS-box
PRINTSPR004042.6E-273859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 92 aa     Download sequence    Send to blast
MGRGKVQVRR IENEVSRQVT FSKRRPGLLK KAHEIAVLCD VDVAAIVFSA KGNLFHYASS  60
HTTITRWCHF SAPLLLPMGE YNVNHSGIFV SQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1egw_A1e-20287177MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_B1e-20287177MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_C1e-20287177MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_D1e-20287177MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1tqe_P2e-20173175Myocyte-specific enhancer factor 2B
1tqe_Q2e-20173175Myocyte-specific enhancer factor 2B
1tqe_R2e-20173175Myocyte-specific enhancer factor 2B
1tqe_S2e-20173175Myocyte-specific enhancer factor 2B
3kov_A2e-20287177Myocyte-specific enhancer factor 2A
3kov_B2e-20287177Myocyte-specific enhancer factor 2A
3kov_I2e-20287177Myocyte-specific enhancer factor 2A
3kov_J2e-20287177Myocyte-specific enhancer factor 2A
3p57_A2e-20287177Myocyte-specific enhancer factor 2A
3p57_B2e-20287177Myocyte-specific enhancer factor 2A
3p57_C2e-20287177Myocyte-specific enhancer factor 2A
3p57_D2e-20287177Myocyte-specific enhancer factor 2A
3p57_I2e-20287177Myocyte-specific enhancer factor 2A
3p57_J2e-20287177Myocyte-specific enhancer factor 2A
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO298257271e-103
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY2500751e-100AY250075.1 Oryza sativa (japonica cultivar-group) MADS20 (MADS20) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015619865.15e-39PREDICTED: MADS-box transcription factor 20
SwissprotQ2QQA36e-41MAD20_ORYSJ; MADS-box transcription factor 20
TrEMBLA2ZKT12e-64A2ZKT1_ORYSI; Putative uncharacterized protein
STRINGBGIOSGA036149-PA6e-64(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP12938398
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69120.13e-28MIKC_MADS family protein